Product / Services
Post Buy Requirement
UA

Uttam Air Products,Pvt,Ltd
Kasturba Gandhi Marg, Delhi

Write a Review
Call Now Call Now

Our Products

  1. Medical And Industrial Gases 4 Products available

  2. Fire Extinguisher

    2 Products available

  3. Gas Cylinder

    1 Products available

  4. Diving Accessories

    1 Products available

  5. Process Control Systems & Equipment

    1 Products available

  6. Medical Equipment

    1 Products available

  7. Gas Plants

    1 Products available

  8. Medical Accessories

    1 Products available
  9. Others Products 8 Products available

Other Products / Services

Our Complete range of products are Life Raft Equipment, Spun Products, medical cylinder, Paintball Cylinder and Life Support Equipment.

Life Raft Equipment

The luxfer advantage most compact, lightest-weight cylinders availableup to 70 percent lighter than steel cylinders.space-age technology: lightweight aluminium liner with carbon fiber and epoxy resin overwrap.only require requalification every five years in u.s.wide range of sizes and capacities.corrosion-resistant interior and exterior unlike corrosion-prone steel cylinders.non-magnetic.
View Complete Details
Ask Latest Price & Details

Spun Products

Luxfer sampling cylinders are the ideal solution for a wide array of sample collection and analysis needs. Tens of thousands of luxfer sampling cylinders are currently in use throughout the world in various industries, including petrochemical refineries and well sites, analytic laboratories, alternative fuel technologies, and manufacturing.
View Complete Details
Ask Latest Price & Details

Medical Cylinder

Luxfer uttam medical products include the worlds most comprehensive range of oxygen cylinders from luxfer uttam gas cylinders, the world leader in high-pressure gas containment. Lightweight, high-performance luxfer uttam medical cylinders provide significant benefits not only for oxygen patients, but also for caregivers, respiratory therapists, nurses, emergency medical personnel and others who regularly use and handle oxygen equipment.
View Complete Details
Ask Latest Price & Details

Paintball Cylinder

Luxfer Uttam Gas Cylinders manufactures the widest range of aluminium and carbon-composite paintball cylinders in the world. With an unmatched record for safety and performance, Luxfer Uttam paintball cylinders have proven to be the strongest, safest and most durable available. By providing the most advanced products and unsurpassed levels of customer service and technical support, Luxfer Uttam Gas Cylinders makes it easy for paintball players of all levels to stay ahead of the game.
View Complete Details
Ask Latest Price & Details

Life Support Equipment

Luxfer Uttam Uttam India, Joint venture entity of Luxfer Uttam Gas Cylinders, the worlds largest manufacturer of aluminium and composite high-pressure gas cylinders, offers the broadest range of high-quality, high-performance life-support gas cylinders available, including all-aluminium, hoop-wrapped composite and full-wrapped composite models. With an unmatched record for safety and performance, Luxfer Uttam life-support cylinders provide unsurpassed service to firefighters, emergency personnel and industrial users of self-contained breathing apparatuses (SCBA) around the globe.
View Complete Details
Ask Latest Price & Details

Beverage Cylinder

Luxfer uttam india, joint venture entity of luxfer gas cylinders, the world's largest manufacturer of aluminium high-pressure gas cylinders, offers the broadest range of high-quality, high-performance co2 and mixed-gas cylinders for beverage service. Clean, corrosion-resistant, lightweight beverage cylinders are ideal for dispensing beers, lagers, ciders, stouts and carbonated soft drinks. With an unmatched record for safety and performance, luxfer co2 beverage cylinders provide unsurpassed beverage service to users around the globe. The luxfer advantage proprietary 6061 alloy, an aluminium-magnesium-silicon blend.luxfer's exclusive 7000-series alloys available in europe and australia.cylinders cycle-tested in excess of 100, 000 cycles at service pressure.minimum burst pressure tested to 2.5 times service pressure without failure.
View Complete Details
Ask Latest Price & Details

Alternative Fuel Pods

Luxfer uses proprietary technology to manufacture its own lightweight aluminium liners for type 3 alternative fuel cylinders of all sizes. Luxfer holds numerous worldwide patents related to cylinder and metallurgical technology because of its active, global research and development program. Look to luxfer for future innovations in alternative fuel cylinders.
View Complete Details
Ask Latest Price & Details

Recreational Equipment

At uttam air products, we offer lots of recreational equipments. Some of which are as as follows: scuba equipmentcylindertanksmasksfinssnorkelspaint ball equipmentballoon filling equipment
View Complete Details
Ask Latest Price & Details

Cng Cylinders

Luxfer uttam india, joint venture entity of luxfer gas cylinders, the worlds largest manufacturer of aluminium high-pressure gas cylinders. When it comes to transportation, one thing has become increasingly clear over the past decade: the world can no longer afford to depend on oil as an energy source. For one thing, the oil supply is simply running out. Demand for oil in both developed and developing countries is rising significantly, and by 2020, the world could face an energy crisis. Even more disturbing is the well-publicized environmental damage being done by exhausts from gasoline and diesel vehicles.
View Complete Details
Ask Latest Price & Details

Fire Extinguishers

The luxfer advantage proprietary 6061 alloy, a balanced aluminium-magnesium-silicon blend exclusive to luxfer; 2001 alloy available in europe.cycle-tested in excess of 100, 000 cycles at service pressure.minimum burst pressure tested to 2.5 times service pressure without failure.lightweightup to 40 percent lighter than most comparable steel cylinders.manufactured to all applicable international standards.corrosion-resistant interior and exterior.ideal even for wet gases.wide range of sizes and capacities.non-magneticconsistent weight.thick, damage-resistant walls.world wide global standards
View Complete Details
Ask Latest Price & Details

Scuba Cylinder

Luxfer uttam india, joint venture entity of luxfer gas cylinders, the worlds largest manufacturer of aluminium high-pressure gas cylinders, offers the broadest range of aluminium and hoop-wrapped composite scuba cylinders, providing divers with high-performance service in waters around the globe. The luxfer advantage proprietary 6061 alloy, a balanced aluminium-magnesium-silicon blend exclusive to luxfer.cycle-tested in excess of 100, 000 cycles at service pressure.minimum burst pressure tested to 2.5 times service pressure without failure.manufactured to all recognized international standards.corrosion-resistant interior and exteriorunlike corrosion-prone steel cylinders.
View Complete Details
Ask Latest Price & Details

Co2 Fire Extinguisher

Carbon dioxide extinguishers contain pressurized liquid carbon dioxide, which turns to gas when expelled. The main advantage of co2 fire extinguishers is that the agent does not leave residue after use. This may be of particular importance if the fire protection is needed in areas with sensitive electronic equipment. Co2 extinguishers are primarily effective on class b or c fires. Keeping in mind our modern day reliance on heavy use of electrical equipment in our daily lives, an easy to use solution must be readily available at the time of emergency.
View Complete Details
Ask Latest Price & Details

Industrial Equipment

At uttam air products, we offer lots of recreational products & equipments.
View Complete Details
Ask Latest Price & Details

Medical Equipment

At uttam air products, we offer lots of medical products & equipments.
View Complete Details
Ask Latest Price & Details

Gas Generation Plants

Uttams engineering excellence can be seen in their capability to build and operate gas generation units of various sizes. Oxygen was first extracted from the atmosphere by a chemical process. This was superseded over 80 years ago by the cryogenic (low temperature) process involving the liquefaction and distillation of air. The cryogenic air separation process is still by far the most widely used. However, non cryogenic techniques first developed during the 1970s -- pressure swing adsorption (psa), and membrane diffusion -- are becoming increasingly significant for smaller or less demanding on-site applications.
View Complete Details
Ask Latest Price & Details

Medical Accessories

Uttam is a leading supplier of specifically designed and developed premium products that serve patients and consumers in multiple markets. A wide range of medical accessories, varies from compressed gas equipment to cylinders, regulators conserving devices, portable oxygen systems, medical bags, and gas filling systems. Uttam is a one stop solution for a wide range of accessories that they provide in an endeavor to service their customers better. Some of our medical accessories include: light weight alumunium and carbon composite cylindersregulatorsvalvesflow metersmasks & tubingstransport carts
View Complete Details
Ask Latest Price & Details
Tell Us What are you looking for? Will call you back

Contact Us

View Contact No.